Veeam installing package transport error 1935 reddit.
Veeam installing package transport error 1935 reddit 1, it is now possible to deploy Veeam Agent for Linux using pre-installed Veeam Deployer Service and add that machine to a Protection Group using certificate-based authentication instead of credentials. Had this issue with Threat Locker in use at customer site. In fact, each Domain or Local user must be assigned a granular grant (RBAC) with the minimum permissions dedicated to the application or service function. Nov 22, 2010 · This still applies to the latest 12. Veeam v11 community was running fine until I upgraded to v12. The ISO file can also be accessed from the KB link posted above. Open the About tab. Trying to test the free version on a test machine. The previous case closed with a fairly environmentally specific issue, so it's best to Open a Support Case and let Veeam Support check the setup logs and gather some information on the environment. Making sure Windows Updates are all done. Firewalls are off on both machines. – Install the Update: Follow the on-screen instructions to install the update. When I attempt to and run as an administrator, I receive the following error: Installation was interrupted, or something did not work, as expected. Mar 17, 2021 · Interesting and maybe completely unrelated, yesterday I updated to latest Veeam v10 patch and I was unable to update the components (proxies etc) because the Veeam transport service was not removed during update (they were removed but the server was still running). May 2, 2023 · 2. Software is installed on a Win10 dedicated PC. Our server is remote and the B&R server is timing out I think when trying to copy over files, as I'm getting a DoRPCWithBinary failure. Premium Backup, Recovery, Data Insights & Resilience. This is a new install of windows 2008 Server. Jan 15, 2020 · Hello, That sounds like a technical issue. Veeam transport components require a 64-bit operating system. The Veeam proxy resided in that DMZ so we could minimize the number of firewall modifications. Sep 20, 2011 · The most common scenario is that the disk(s) of the VM being processed cannot be attached to the VMware Backup Proxy, for example: The VM (Virtual Machine) being processed was added to the job through a standalone ESXi host (as opposed to through a vCenter Server), and the VM acting as VMware Backup Proxy is on a different ESXi host. Install them on your system by running the downloaded vcredist setup file. The packages you need to install are: VeeamHvintegration. Veeam Installer Service for Linux Dec 12, 2019 · I am trying to install a Veeam Backup and Replication agent to an Exchange server, but it fails on me with the following error: “Installing package Veeam Agent for Hi everyone, I am currently trying to deploy the veeam agent with a software over the network. Dec 14, 2022 · Installing Installer service Error: Error: error: can't create transaction lock on /var/lib/rpm/. msi file located at C:\Program Files\Veeam\Backup and Replication\Backup\Packages. e. 2 update from the official Veeam website or your Veeam account portal. Error code 0x80070005. Apr 22, 2015 · While continuing investigation with support, you can try to install the required package manually (VeeamTransport. NET and/or uninstall/reinstall. Installation result: 3 Failed to install the management agent. Copy from the Veeam installation machine to the Hyper-V host and run. msi) the package fails to install, and the following errors may be displayed in the UI: Installing package Transport Error: Error 1935. Mar 6, 2019 · Hi Jochen, looks like LocalSystem account, used to install the package remotely, doesn't have access to certificates, while when you install it manually using local user, everything is ok. Please keep working with support team and let us know how the investigation goes. Running the package on a second Veeam server using the same patch under the same domain and it completes without any problem. 1 release. 0. Installation was interrupted before application could be installed. adding the server as general purpose and CDP proxy works just fine but when I try to add it as vmware proxy it s Oct 20, 2015 · v. Every day when the recan of manually added job runs, I get a warning for that server: "Failed to install package: backup job is in progress on the target host". What ports need to be opened for veeam to work correctly? I'm attempting to add a new Hyper-V Standalone Host to my infrastructure. This helps draw a line in the sand between a Microsoft problem and a problem with your installer. exe by itself to install the main product and then run the installs for any explorers that were applicable. Automatic installation by using domain group policies. Automatic installation by using a logon script. Tech Explained Nov 5, 2024 · Hi everyone,I have 2 servers with VBR and I’m trying to connect one of those as a backup proxy of the other, so i can manage backups from a single backup server and disable the other one. Nov 12, 2012 · When Veeam Backup & Replication attempts to install the Veeam Transport package (VeeamTransport. We have updated Veeam to v10 a few weeks ago but got interrupted by a sudden Covid19 lockdown before we could update "Hyper-V Integration", "Mount Server, "Transport" and "vPower NFS" components on the managed server (single Hyper-V host environment). The wizard finds the server ok, tells me that the transport package is installed (it isn't) and that the hyper-v integration is not installed. In fact, each Domain or Local user must be assigned a granular grant (RBAC) with the Dec 8, 2021 · Installing the Veeam Backup Transport 20211123 patch seems to be hung. The Veeam proxy in a DMZ was trying to backup some VMs in that DMZ. Installation by using the standard third-party software distribution tool. Completion bar just keeps cycling for over 30 min now. When launching the V12 console, it asks for an Host upgrade which arrives to an error:“failed to upgrade host comp Feb 21, 2022 · The existing version of the Veeam Installer Service must be uninstalled before installing a new version. Aug 6, 2021 · During the installation process, Veeam installers extract and execute files from the temporary folder. Without case number, the topic will eventually be deleted by moderators. DSM is technically based on Debian, but it is a rather modified variant. even to the point of clean (re)install, it’s best to get ahold of Support. Backup365. Thanks. I recommend you install a Win Server 2019 or 2022 server and try again. Run windows installer cleanup utility tool to remove existing acrobat contents on the computer. Collect Veeam Logs If the Veeam Backup & Replication Console is accessible, use the built-in log collection tool to gather logs from the server where the service is failing to start. It failed via the install so I tried installing (via packages) as the local administrator and also as the domain administrator. Jan 12, 2016 · First up you need to get a hold of the installation files. . Oct 24, 2019 · If you mean " c:>net use \\Hostname\Admins$ " this command, it shows results as below. May 29, 2013 · Is there a way to manually upgrade the transport service on a backup proxy server. msi) can be found under the Backup/Packages/. rpm. Mar 19, 2014 · Instead using a bootstrapper/chainer (WiX Burn, InstallShield Setup Prereqs or Suite Installation ) to install the stand alone versions of the redist from Microsoft. 11/1/2023 8:10:00 AM Creating temporary folder 11/1/2023 8:10:11 Sign in now. An error occurred during the installation of assembly component KB ID: 1689 Product: Veeam Backup & Replication | 12 [Not applicable to protection groups for pre-installed Veeam Agents and protection group for cloud machines] To deploy Veeam Installer Service and Veeam Agent for Microsoft Windows on a protected computer, Veeam Backup & Replication uses the administrative share (admin$) of the target computer. For example, the C:\Program Files (x86)\Veeam\Backup Transport\x64\vddk_7_0\ folder is empty. These are located on your Veeam Backup and Replication server under the path C:\Program Files\Veeam\Backup and Replication\Packages – You will find there the individual packages for each service that Veeam provides (mount, transport, tape, etc). msi). 7739-x64_template. (correctly). These steps must be performed on the machine where Veeam Agent for Microsoft Windows is failing to deploy. 2022 10:57:53]]INFO] Creating Installer Application instance. From the DigiCert certificate page, download the . You might want to consider taking a snapshot before this work, so when you discover what fixes the problem you can revert the snapshot and just implement the fix cleanly. Veeam Support Engineers can review the service logs to help identify why the service won't start. Dec 7, 2011 · As the install is via a wan connection between backup-server and proxy-server, i assume there is some firewall rule in place causing this problem. Windows; Android; iPhone; Technical Submenu. Someone got any idea for me ? Sep 3, 2024 · – Download the Update: Obtain the Veeam 12. However, when I get to adding the Linux server which will be the repo, Veeam won't install the transport components because it thinks the Debian install isn't 64 bit. >08. Advanced Secure Backup, Recovery & Data Insights. The issue can be further identified by reviewing the installer log files found in C:\ProgramData\Veeam\Setup. When the download is complete, click Install to run the setup archive. The actual configuration of the Veeam instances is backed up with 10 versions on a repo if you're worried about jobs and such Jul 2, 2018 · Starting in Veeam Backup & Replication v12. It always fails and even if I try to install the MSI… Upon looking around, it turns out that the new version of Veeam tries to use dpkg to install a resident copy of the installer and transport service, but TrueNas SCALE has dpkg restricted or blocked so it cannot be used. If you’re not able to uninstall the components on the managed server(s) and install the ‘old Veeam components’, then upgrade them. Nov 1, 2023 · 11/1/2023 8:09:37 AM Starting infrastructure item update process 11/1/2023 8:09:37 AM Collecting hardware info 11/1/2023 8:09:37 AM Detecting operating system 11/1/2023 8:10:00 AM Warning Detecting OS version Failed to detect OS version: Failed to connect to WMI on host '<MyIP>'. Try running this code to fix the transaction support from the terminal. Download 30-day trials for any Veeam product, including offerings for individual features, small businesses, service providers, and FREE community editions. 08. msi; VeeamTransport. Apr 16, 2024 · Return to the Veeam Backup & Replication Console, and reattempt the Component Update. The prerequisites install ok, then once I kick off the rest of the install, the status bar loops for a couple minutes during the initial "Installing Microsoft SQL Server 2012 Service Pack 1 Express" phase. I am trying to evaluate this but cannot get the agent to install on our Exchange 2010 machine. For more information, see the installation logs. Close. DaVinci Resolve is an industry-standard tool for post-production, including video editing, visual effects, color correction, and sound design, all in a single application! Aug 23, 2024 · To upgrade Veeam Agent for Microsoft Windows: Double-click the Veeam Agent icon in the system tray, or right-click the Veeam Agent icon in the system tray and select Control Panel. Eremin wrote:Can you also try to install required packages manually and, then, re-add proxy? Required package (VeeamTransport. Mar 20, 2021 · Standalone backup agent for Microsoft Windows servers and workstations (formerly Veeam Endpoint Backup FREE) Feb 8, 2024 · The Veeam world is a different world. Foundation Secure Backup with Instant Recovery Jan 17, 2021 · I’d try installing the Report Viewer manually and then if the Veeam install continues to crap out, maybe repair . Mar 14, 2023 · The only thing "unsupported" perhaps is the distro of Linux. Fix 5 – Fix the Transaction Support. msi; VeeamInstallerSvc. An error occurred during the installation of assembly component {98CB24AD-52FB-DB5F-A01F-C8B3B9A1E18E}. The wizard didn't seem to like something about our system. Apr 6, 2018 · Download and Install Missing Certificates. The solution for us? Veeam support recommeded installing Microsoft C/C++ Redistributable 2013 on the proxy in the DMZ. Unless you have a massive environment, I'd just say let it use that. All B&R roles running on a Windows 2019 Standard 16GB 4-vCPU. If the new version of Veeam Agent is available, click Download. Feb 25, 2022 · Based on the case details the upgrade issue occurs with one on the Veeam B&R infrastructure components (transport service for the Hyper-V host) and not Veeam Agent for Windows (backup agent). The issue started when Windows Update offered me an optional "Bluetooth with Enhanced Data Apr 15, 2025 · This was due to UAC being triggered, which prevented Veeam from installing the packages. msi can be found in the Backup/Packages folder). When I click apply, it reports : Dec 1, 2022 · thank you @vmJoe for sharing, however those who are Wintel system administrators and are devoted to siciurity have a deep understanding of the subject. This change ensures that the VDDK libraries are only installed on managed servers that need to interact directly with VMware ESXi. lock (Permission denied) • Exit code: 1 Debian-based Linux distributions Installing Installer service Error: Error: dpkg: error: requested operation requires superuser privilege Exit code: 2 Aug 9, 2022 · Unable to install Veeam Version 5. msiC:Program FilesVeeamBackup and Feb 27, 2023 · Dear Community,our installation is based on a single Hyper-V host with 3 VMs. , welcome to the forums. Our backups run fine as we are still testing those. Then you will be able to use the upgrade option in the Veeam console. The error experienced is in reference to the Windows Installer Service experiencing an issue and getting access denied. Required package (VeeamTransport. Nov 11, 2012 · Challenge When Veeam Backup & Replication attempts to install the Veeam Transport package (VeeamTransport. Review the Update Procedure for Windows Computers section of the Veeam Agent Managed User Guide for more information on updating Windows computers associated with a 'Computers with pre-installed agents' Protection Group. Apr 7, 2022 · Starting with Veeam Backup & Replication (VBR) v12. The process typically involves stopping Veeam services, applying the update, and We were having that exact problem after we upgraded to Veeam 10. Then I get "Setup Failed. Apr 20, 2011 · Veeam Community discussions and solutions for: [SOLVED] Service not running of Veeam Agents for Linux, Mac, AIX & Solaris Jul 2, 2018 · There are also ways to manually install the Veeam Transport Service that might be more helpful. Unfortunately, I am not able to install Veeam Backup on that new Windows Server 2012. The Windows OS may fail to load the VDDK libraries if they are missing components. One possible solution is to manually install the packages on the host and then add the host to Veeam. tryllz (tryllz) January 18, 2021, 6:04am Hi, I recently lost my laptop's (a Lenovo X201t running Win Ultimate (64-bit) entire Bluetooth capabilities. Windows patches were installed on all affected servers before Veeam patch. Mar 14, 2025 · At this point, since you’ve done about all we can suggest to doi. 1. Jul 3, 2018 · Note: Prior to Veeam Backup & Replication 12. Jan 17, 2024 · Hi Sebastien D. Unpacking installation files Extracting packages System platform: x64 Installing management agent Cannot find the management agent package veeamma-6. 03 onto my computer. crt file for the following Certificates: Jun 13, 2010 · Hi Krolike, Step 1: Remove all components or products of acrobat and then try installing. I'm a bit surprised, since the installation worked fine on the first Server 2012. Oct 2, 2018 · I've got a Windows Agent installed on a 2016 server, and it shows up normally in the "Manually Added" list of agents along with my other ten 2016 servers. So, I agree with you on that point. msi Mar 22, 2024 · Manual installation by running the VeeamInstallerSvc. We would like to show you a description here but the site won’t allow us. 2, the VDDK libraries are deployed as a separate package from veeamtransport. "The command completed successfully" All checklists specified in KB have been checked. Aug 12, 2023 · Veeam Community discussions and solutions for: Veeam B&R Linux Proxy issues (c++ libraries missing) of VMware vSphere Jun 23, 2016 · Platform Editions. Installing package Transport Error: Error 1935. PC & Mobile Submenu. Depending on what services your proxy Mar 14, 2022 · So I would think there are two options here - Open a Support ticket to see if they have a quick fix for this; Uninstall VBR completely and then reinstall it again pointing to your DB you are using - this way you don’t loose anything and can take a configuration backup beforehand just in case. Next Steps: Please ensure your host has all necessary Windows updates in place, reboot it, then attempt to reinstall the software again. Please provide a support case ID for this issue, as requested when you click New Topic. The default Veeam install usually comes with sql express, which is free anyways. 2, the VDDK libraries were included with the Veeam Transport package (VeeamTransport. Mar 7, 2013 · I am trying to move a Veeam installation from one Windows Server 2012 (HP ML110) to another Windows Server 2012 (ML350G5). My suggestion to you is, if you are installing on a virtual server, can you create a new virtual server and install it again? There may be a problem with the registry or a different configuration of the current virtual presentation. Jul 19, 2011 · Collect Logs and Open a Veeam Support Case. Note: If the managed server where the Veeam WAN Accelerator component was upgraded is still assigned the WAN Accelerator role, edit its properties and update the WAN Cache path. Apr 20, 2021 · The solution was to run the Veeam. sncxmzhdxzbihxqqvfygnctngixqeisgeftlaivdgpfddivpvhcgedmfabyzkuacbcyz